Growth Factors & Cytokines Recombinant Proteins

Human LGALS7 Recombinant Protein (RPPB0284)

(No reviews yet) Write a Review
SKU:
RPPB0284
Product Type:
Recombinant Protein
Species:
Human
Uniprot:
P47929
Research Area:
Growth Factors & Cytokines

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:Human LGALS7 Recombinant Protein
Product Code:RPPB0284
Size:10µg
Species:Human
Target:LGALS7
Synonyms:Galectin-7, Gal-7, HKL-14, PI7, p53-induced gene 1 protein, LGALS7, PIG1, LGALS7B, GAL7, LGALS7A.
Source:Escherichia Coli
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:LGALS7 was lyophilized from a concentrated (1mg/ml) solution in�20mM Tris, 150mM NaCl, 1mM EDTA and 5% Trehalose, pH 8.
Solubility:It is recommended to reconstitute the lyophilized Galectin-7 in sterile�distilled H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions.
Stability:Lyophilized LGALS7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Galectin-7 should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles.
Purity:Greater than 95.0% as determined by SDS-PAGE.
Amino Acid Sequence:MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF

Galectins are a family of animal lectins with an affinity for beta-galactosides. This family has at least 14 identified members. Galectins share similarities in the CRD (the carbohydrate recognition domain). Galectins are synthesized as cytosolic proteins. Though localized principally in the cytoplasm and lacking a classical signal peptide, galectins can also be stimulated to secretion by non-classical pathways or alternatively targeted to the nucleus. Galectins are involved in modulating cell-cell and cell-matrix interactions. Human Galectin-7 belongs to the prototypical Galectins containing a single CRD, which is initially identified in human epidermis as a monomer. The Galectin-7 expression is induced by tumor suppressor protein p53 and associated with apoptosis. Galectin-7 is a pro-apoptotic protein which functions intracellularlly upstream of JNK activation and mitochondrial cytochrome c release. The correlation of Galectin-7 with the UV-induced apoptosis of keratinocytes presents a critical mechanism in the maintenance of epidermal homeostasis. Human Galectin-7 is localized in both nucleus and cytoplasm.

Galectin-7 Human Recombinant produced in E.Coli is a single,�non-glycosylated, Polypeptide chain containing 136 amino acids and having a molecular mass of 15kDa.The LGALS7 is purified by proprietary chromatographic techniques.

UniProt Protein Function:LGALS7B: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
UniProt Protein Details:

Protein type:Apoptosis; Cell adhesion

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: cytoplasm; extracellular space; nucleus

Molecular Function:carbohydrate binding

Biological Process: apoptosis; heterophilic cell adhesion

NCBI Summary:The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:3963) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008]
UniProt Code:P47929
NCBI GenInfo Identifier:1346431
NCBI Gene ID:653499
NCBI Accession:P47929.2
UniProt Secondary Accession:P47929,Q6IB87,
UniProt Related Accession:P47929
Molecular Weight:15,075 Da
NCBI Full Name:Galectin-7
NCBI Synonym Full Names:lectin, galactoside binding soluble 7B
NCBI Official Symbol:LGALS7B��
NCBI Official Synonym Symbols:PI7; GAL7; Gal-7; HKL-14; LGALS7��
NCBI Protein Information:galectin-7
UniProt Protein Name:Galectin-7
UniProt Synonym Protein Names:HKL-14; PI7; p53-induced gene 1 protein
Protein Family:Galectin
UniProt Gene Name:LGALS7��
UniProt Entry Name:LEG7_HUMAN
View AllClose

0 Reviews

View AllClose

Related Products

Human Galectin-7/LGALS7 Recombinant Protein (RPES0450)

Human Galectin-7/LGALS7 Recombinant Protein (RPES0450)

Cell Death Recombinant Proteins

system_update_altDatasheetHuman Galectin-7/LGALS7 Recombinant Protein LGALS7; also known as Galectin-7; is a member of the galectins family. The galectins are a family of beta-galactoside-binding