Human IL-29 Recombinant Protein (N-His) (active)
- SKU:
- RPES6423
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human IL-29 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6423 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | IFN-λ1 |
| Mol Mass: | 22.72 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce IL-8 secretion in HuH7 cells. The ED50 for this effect is < 6 ng/mL. |
| Sequence: | MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
| Accession: | Q8IU54 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets: is primarily active in epithelial cells and this cell type-selective action is because of the epithelial cell-specific expression of its receptor IFNLR1. Exerts an immunomodulatory effect by up-regulating MHC class I antigen expression. |
Related Products
Human IL-9 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-9 Recombinant Protein (N-His) (active)Product Code:RPES6410Size:20µgSpecies:Human
Human IL-19 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-19 Recombinant Protein (N-His) (active)Product Code:RPES6415Size:20µgSpecies:Human
Human IL-25 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-25 Recombinant Protein (N-His) (active)Product Code:RPES6419Size:20µgSpecies:Human
Human IL-26 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-26 Recombinant Protein (N-His) (active)Product Code:RPES6420Size:20µgSpecies:Human
Human IL-5 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-5 Recombinant Protein (N-His) (active)Product Code:RPES6409Size:20µgSpecies:Human