Human IL-12 p35 Recombinant Protein (N-His) (active)
- SKU:
- RPES6412
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human IL-12 p35 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6412 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | Interleukin-12 subunit alpha, IL-12 subunit p35, IL-12A, Cytotoxic Lymphocyte Maturation Factor 35 kDa |
| Mol Mass: | 25.70 kDa |
| Tag: | N-His |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBMC). The ED50 for this effect is < 49 pg/mL. |
| Sequence: | MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
| Accession: | P29459 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. |
Related Products
Mouse IL-12 p35 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-12 p35 Recombinant Protein (N-His) (active)Product Code:RPES6687Size:20µgSpecies:Mouse
Human IL-12 p40 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-12 p40 Recombinant Protein (N-His) (active)Product Code:RPES6499Size:20µgSpecies:Human
Human IL-19 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-19 Recombinant Protein (N-His) (active)Product Code:RPES6415Size:20µgSpecies:Human
Human IL 12 p35 Recombinant Protein (RPPB0566)
Cytokines Recombinant Proteins
system_update_altDatasheetsystem_update_altMSDS
Human IL-9 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-9 Recombinant Protein (N-His) (active)Product Code:RPES6410Size:20µgSpecies:Human