Description
| Product Name: | Human IFN a 2a Recombinant Protein |
| Product Code: | RPPB0382 |
| Size: | 100µg |
| Species: | Human |
| Target: | IFN a 2a |
| Synonyms: | Leukocyte IFN, B cell IFN, Type I IFN, IFNA2, IFN-a 2a. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | Lyophilized without additives. |
| Solubility: | It is recommended to reconstitute the lyophilized IFNA2A in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized IFNA-2A although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IFN-alpha 2a should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 97.0% as determined by both:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEM IQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAV RKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEN-terminal methionine has been completely removed enzymatically |
| Biological Activity: | The specific activity as determined in a viral resistance assay using bovine kidney MDBK cells was found to be 270,000,000 IU/mg. |
IFN-alpha is produced by macrophages and has antiviral activities. IFN stimulates the production of two enzymes: protein kinase and an oligoadenylate synthetase.
IFN�Alpha Human 2a Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 165 amino acids and having a molecular mass of 19241 Dalton.�The difference between IFNA2A and IFNA2B is in the amino acid present at position 23. IFN-alpha 2a has a lysine at that position 23 while IFN-alpha 2b has arginine.The IFNA2A�gene was obtained from human leukocytes.The IFNA2A is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | Produced by macrophages, IFN-alpha have antiviral activities. |
| NCBI Summary: | This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Use of the recombinant form of this protein has been shown to be effective in reducing the symptoms and duration of the common cold. [provided by RefSeq, Jun 2011] |
| UniProt Code: | P01563 |
| NCBI GenInfo Identifier: | 124449 |
| NCBI Gene ID: | 3440 |
| NCBI Accession: | P01563.1 |
| UniProt Secondary Accession: | P01563,P01564, Q14606, Q6DJX8, Q96KI6, H2DF54, H2DF55 |
| UniProt Related Accession: | P01563 |
| Molecular Weight: | 21,550 Da |
| NCBI Full Name: | Interferon alpha-2 |
| NCBI Synonym Full Names: | interferon alpha 2 |
| NCBI Official Symbol: | IFNA2�� |
| NCBI Official Synonym Symbols: | IFNA; INFA2; IFNA2B; IFN-alphaA�� |
| NCBI Protein Information: | interferon alpha-2 |
| UniProt Protein Name: | Interferon alpha-2 |
| UniProt Synonym Protein Names: | Interferon alpha-A; LeIF A |
| UniProt Gene Name: | IFNA2�� |
Additional Information
Product Type: |
Recombinant Protein |
Species: |
Human |
Uniprot: |
P01563 |
Research Area: |
Cytokines |