Human HMGB1 Recombinant Protein (N-His) (active)
- SKU:
- RPES6452
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human HMGB1 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6452 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | HMG-1, HMG1, HMG3, SBP-1 |
| Mol Mass: | 25.72 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce TNF alpha in RAW264. 7 cells. The ED50 for this effect is < 10 μg/mL. |
| Sequence: | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Accession: | P09429 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | High mobility group protein B1 is a member of the HMGB family consisting of three members; HMGB1; HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein; HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile; it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte; T cell; dendritic cell activities in inflammatory responses. |
Related Products
Human HMGB1 Recombinant Protein (His tag)
OverviewProduct Name:Human HMGB1 Recombinant Protein (His tag)Product Code:RPES6066Size:20µgSpecies:HumanExpres
Human CD27L Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD27L Recombinant Protein (N-His) (active)Product Code:RPES6430Size:20µgSpecies:Human
Human TWEAK Recombinant Protein (N-His) (active)
OverviewProduct Name:Human TWEAK Recombinant Protein (N-His) (active)Product Code:RPES6436Size:20µgSpecies:Human
Human VEGF165 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human VEGF165 Recombinant Protein (N-His) (active)Product Code:RPES6434Size:20µgSpecies:Human<
Human CXCL6 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL6 Recombinant Protein (N-His) (active)Product Code:RPES6502Size:20µgSpecies:Human