Description
| Product Name: | Human GUCA2B Recombinant Protein |
| Product Code: | RPPB1282 |
| Size: | 10µg |
| Species: | Human |
| Target: | GUCA2B |
| Synonyms: | Guanylate cyclase activator 2B, UGN, GCAP-II, GUCA2B. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered clear solution. |
| Formulation: | 20mM TRIS, 50mM NaCl and 20% (v/v) glycerol, pH 7.5. |
| Stability: | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.�For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. |
| Purity: | Greater than 95.0% as determined by�SDS-PAGE. |
| Amino Acid Sequence: | MKHHHHHHASVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL |
Prouroguanylin is a 112-amino-acid prohormone precursor of uroguanylin- mature biologically active 16-amino-acid peptide cleaved from its C-terminus. Guanylin binds to receptor-guanylate cyclases (CG-C) resulting in increased intracellular cGMP levels leading to CFTCR (Cystic Fibrosis Transmembrane Conductance Regulator) activation and subsequent rise in fluid and electrolyte secretion into the lumen.Prouroguanyline knock-out mice showed impaired renal excretion of external NaCl leading to elevated blood pressure independent of the level of diatary salt intake.Prouroguanylin is the predominant circulating molecular form found in circulation and in biological fluids.
Prouroguanylin Human Recombinant is 10.7 kDa protein containing 86 amino acid residues of the human prouroguanylin and 10 additional amino acid His Tag.The Prouroguanylin is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | GUCA2B: Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport. Belongs to the guanylin family. |
| UniProt Protein Details: | Protein type:Secreted; Secreted, signal peptide Chromosomal Location of Human Ortholog: 1p34-p33 Molecular Function:calcium sensitive guanylate cyclase activator activity |
| NCBI Summary: | This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this peptide to its cognate receptor stimulates an increase in cyclic GMP and may regulate salt and water homeostasis in the intestine and kidneys. [provided by RefSeq, Nov 2015] |
| UniProt Code: | Q16661 |
| NCBI GenInfo Identifier: | 2495130 |
| NCBI Gene ID: | 2981 |
| NCBI Accession: | Q16661.1 |
| UniProt Secondary Accession: | Q16661,Q52LV0, |
| UniProt Related Accession: | Q16661 |
| Molecular Weight: | 12,069 Da |
| NCBI Full Name: | Guanylate cyclase activator 2B |
| NCBI Synonym Full Names: | guanylate cyclase activator 2B |
| NCBI Official Symbol: | GUCA2B�� |
| NCBI Official Synonym Symbols: | UGN; GCAP-II�� |
| NCBI Protein Information: | guanylate cyclase activator 2B |
| UniProt Protein Name: | Guanylate cyclase activator 2B |
| UniProt Synonym Protein Names: | Guanylate cyclase C-activating peptide 2Alternative name(s):Guanylate cyclase C-activating peptide II; GCAP-II |
| Protein Family: | Guanylate cyclase activator |
| UniProt Gene Name: | GUCA2B�� |
| UniProt Entry Name: | GUC2B_HUMAN |
Additional Information
Product Type: |
Recombinant Protein |
Species: |
Human |
Uniprot: |
Q16661 |
Research Area: |
Hormones |