Human GNLY Recombinant Protein (RPPB3625)
- SKU:
- RPPB3625
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- P22749
Description
| Product Name: | Human GNLY Recombinant Protein |
| Product Code: | RPPB3625 |
| Size: | 10µg |
| Species: | Human |
| Target: | GNLY |
| Synonyms: | LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives. |
| Solubility: | It is recommended to reconstitute the lyophilized Granulysin in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Granulysin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH |
GNLY is part of the SAPLIP family and is located in the cytotoxic granules of T cells, which are discharged upon antigen stimulation. GNLY is localized in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. GNLY is an antimicrobial protein that kills intracellular pathogens. GNLY is active against a wide range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.
GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | GNLY: Antimicrobial protein that kills intracellular pathogens. Active against a broad range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis. 2 isoforms of the human protein are produced by alternative splicing. |
| UniProt Protein Details: | Protein type:Secreted; Secreted, signal peptide Chromosomal Location of Human Ortholog: 2p11.2 Cellular Component: extracellular space Biological Process: killing of cells of another organism; defense response to bacterium; cellular defense response; defense response to fungus |
| NCBI Summary: | The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| UniProt Code: | P22749 |
| NCBI GenInfo Identifier: | 116242500 |
| NCBI Gene ID: | 10578 |
| NCBI Accession: | P22749.3 |
| UniProt Secondary Accession: | P22749,P09325, Q6GU08, |
| UniProt Related Accession: | P22749 |
| Molecular Weight: | 14,853 Da |
| NCBI Full Name: | Granulysin |
| NCBI Synonym Full Names: | granulysin |
| NCBI Official Symbol: | GNLY�� |
| NCBI Official Synonym Symbols: | 519; LAG2; NKG5; LAG-2; D2S69E; TLA519�� |
| NCBI Protein Information: | granulysin; lymphokine LAG-2; lymphocyte-activation gene 2; T-cell activation protein 519; T-lymphocyte activation gene 519 |
| UniProt Protein Name: | Granulysin |
| UniProt Synonym Protein Names: | Lymphokine LAG-2; Protein NKG5; T-cell activation protein 519 |
| Protein Family: | Granulysin |
| UniProt Gene Name: | GNLY�� |
| UniProt Entry Name: | GNLY_HUMAN |
Related Products
Human Acrp30 Protein Recombinant Protein (RPPB5717)
Cytokines Recombinant Proteins
Human PIP Protein Recombinant Protein (RPPB0886)
Growth Factors & Cytokines Recombinant Proteins
Human TGFB1 Recombinant Recombinant Protein (RPPB0968)
Growth Factors & Cytokines Recombinant Proteins