Neurotrophins Recombinant Proteins
Human GMFB Recombinant Protein (RPPB0362)
- SKU:
- RPPB0362
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- P60983
- Research Area:
- Neurotrophins
Description
Product Name: | Human GMFB Recombinant Protein |
Product Code: | RPPB0362 |
Size: | 10µg |
Species: | Human |
Target: | GMFB |
Synonyms: | Glia maturation factor beta, GMFB, GMF-B, GMF-beta, GMF. |
Source: | Escherichia Coli |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | The GMF-beta protein was lyophilized after dialysis against 20mM PBS pH=7.4 and 130mM NaCl. |
Solubility: | It is recommended to reconstitute the lyophilized GMFB in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized GMF-B although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GMF-beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Purity: | Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Amino Acid Sequence: | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNTEDLTEEWLREKLGFFH |
Glia Maturation Factor-Beta (GMF-Beta) is a 17 kDa protein nerve gorwth factor identified as a growth and differentiation factor in the vertebrate brain.Glia Maturation Factor-Beta stimulates differentiation of normal neurons as well as glial cells. GMFB inhibits the proliferation of the N-18 neuroblastoma line and the C6 glioma line while promoting their phenotypic expression.GMF-beta inhances the phenotypic expression of glia & neurons thus inhibits the proliferation of their respective tumors when added to cell culture. Although astrocytes produce GMF-b and stores it inside the cells, they don�t secrete the GMF-B into the cultured medium. Cell- surface GMFb acts on the target cells at close range when cells are in direct contact. GMF-Beta is produced by thymic epithelial cells and plays an important role in T cell development in favor of CD4+ T cells.GMF-Beta is a brain-specific protein which belongs to the actin-binding proteins (ADF) family. GMF-beta appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto-immune diseases, possibly through its ability to induce the production and secretion of various pro-inflammatory cytokines.
Glia Maturation Factor-Beta (GMF-Beta) Human Recombinant produced in E.Coli is a signle, non-glycosylated, polypeptide chain containing 141 amino acids and having a total molecular mass of 16.5 kDa. Glia Maturation Factor-Beta, GMF-Beta, Human Recombinant is purified by proprietary chromatographic techniques.
UniProt Protein Function: | GMF-beta: This protein causes differentiation of brain cells, stimulation of neural regeneration, and inhibition of proliferation of tumor cells. Belongs to the actin-binding proteins ADF family. GMF subfamily. |
UniProt Protein Details: | Protein type:Inhibitor; Motility/polarity/chemotaxis; Actin-binding Chromosomal Location of Human Ortholog: 14q22.2 Molecular Function:enzyme activator activity; protein kinase inhibitor activity; signal transducer activity Biological Process: nervous system development; protein amino acid phosphorylation; signal transduction |
UniProt Code: | P60983 |
NCBI GenInfo Identifier: | 46577593 |
NCBI Gene ID: | 2764 |
NCBI Accession: | P60983.2 |
UniProt Secondary Accession: | P60983,P17774, Q9BS35, B2R499, |
UniProt Related Accession: | P60983 |
Molecular Weight: | 16,713 Da |
NCBI Full Name: | Glia maturation factor beta |
NCBI Synonym Full Names: | glia maturation factor beta |
NCBI Official Symbol: | GMFB�� |
NCBI Official Synonym Symbols: | GMF�� |
NCBI Protein Information: | glia maturation factor beta |
UniProt Protein Name: | Glia maturation factor beta |
Protein Family: | Glia maturation factor |
UniProt Gene Name: | GMFB�� |
UniProt Entry Name: | GMFB_HUMAN |