Human G-CSF Recombinant Protein (N-His) (active)
- SKU:
- RPES6472
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human G-CSF Recombinant Protein (N-His) (active) |
| Product Code: | RPES6472 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | CSF-3, MGI-1G, GM-CSF beta, pluripoietin |
| Mol Mass: | 22.37 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is < 50 pg/mL. The specific activity of recombinant human G-CSF is > 2 x 107IU/mg. |
| Sequence: | MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
| Accession: | Q8N4W3 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. |
Related Products
Human M-CSF Recombinant Protein (N-His) (active)
OverviewProduct Name:Human M-CSF Recombinant Protein (N-His) (active)Product Code:RPES6471Size:20µgSpecies:Human
Mouse G-CSF Recombinant Protein (N-His)
OverviewProduct Name:Mouse G-CSF Recombinant Protein (N-His)Product Code:RPES6722Size:20µgSpecies:MouseExpressi
Human CD27L Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD27L Recombinant Protein (N-His) (active)Product Code:RPES6430Size:20µgSpecies:Human
Human TWEAK Recombinant Protein (N-His) (active)
OverviewProduct Name:Human TWEAK Recombinant Protein (N-His) (active)Product Code:RPES6436Size:20µgSpecies:Human
Swine GM-CSF Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine GM-CSF Recombinant Protein (N-His) (active)Product Code:RPES6867Size:5µgSpecies:Porcine<