Enzymes Recombinant Proteins
Human FLT1 D3 Recombinant Protein (RPPB5838)
- SKU:
- RPPB5838
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- P17948
- Research Area:
- Enzymes
Description
Product Name: | Human FLT1 D3 Recombinant Protein |
Product Code: | RPPB5838 |
Size: | 10µg |
Species: | Human |
Target: | FLT1 D3 |
Synonyms: | FLT-1, FLT1, Tyrosine-protein kinase receptor FLT, Flt-1, Tyrosine-protein kinase FRT, Fms-like tyrosine kinase 1, VEGFR-1. |
Source: | Insect Cells |
Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
Formulation: | FLT1 D1-3 was lyophilized from a concentrated (1mg/ml) sterile solution containing 1xPBS. |
Solubility: | It is recommended to reconstitute the lyophilized FLT1 D3 in sterile water not less than 100 �g/ml, which can then be further diluted to other aqueous solutions. |
Stability: | Lyophilized FLT-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FLT1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
Purity: | Greater than 90.0% as determined by SDS-PAGE. |
Amino Acid Sequence: | SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSY |
Biological Activity: | The activity of FLT1D1-3 was determined by its ability to inhibit the VEGF-165-induced proliferation of HUVE cells. |
Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes, dendritic cells and on trophoblast cells. The flt-1 gene was first described in 1990. The receptor contains seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular splited tyrosine kinase domain. Compared to VEGFR-2 the Flt-1 receptor has a higher affinity for VEGF but a weaker signaling activity. VEGFR-1 thus leads not to proliferation of endothelial cells, but mediates signals for differentiation. Interestingly a naturally occuring soluble variant of VEGFR-1 (sVEGFR-1) was found in HUVE supernatants in 1996, which is generated by alternative splicing of the flt-1 mRNA. The biological functions of sVEGFR-1 still are not clear, but it seems to be an endogenous regulator of angiogenesis, binding VEGF with the same affinity as the full-length receptor.
FLT1 D1-3 Human Recombinant produced in baculovirus is monomeric, glycosylated, polypeptide containing 327 amino acids and having a molecular mass of 45 kDa. The soluble receptor protein contains only the first 3 extracellular domains, which contain all the information necessary for binding of VEGF.The FLT1 is purified by proprietary chromatographic techniques.
UniProt Protein Function: | VEGFR1: a receptor tyrosine kinase of the VEGFR family. Receptor for VEGF, VEGFB and PGF. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. Two splice variant isoforms have been described. Isoform SFlt1 may have an inhibitory role in angiogenesis. |
UniProt Protein Details: | Protein type:Protein kinase, TK; EC 2.7.10.1; Protein kinase, tyrosine (receptor); Kinase, protein; Membrane protein, integral; TK group; VEGFR family Chromosomal Location of Human Ortholog: 13q12 Cellular Component: extracellular space; focal adhesion; integral to plasma membrane; plasma membrane; receptor complex; endosome Molecular Function:identical protein binding; vascular endothelial growth factor receptor activity; protein binding; growth factor binding; transmembrane receptor protein tyrosine kinase activity; ATP binding Biological Process: cell migration; peptidyl-tyrosine phosphorylation; protein amino acid autophosphorylation; positive regulation of phosphoinositide 3-kinase activity; positive regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of phosphoinositide 3-kinase cascade; patterning of blood vessels; monocyte chemotaxis; positive regulation of MAP kinase activity; positive regulation of angiogenesis; positive regulation of MAPKKK cascade; positive regulation of cell proliferation; blood vessel morphogenesis; embryonic morphogenesis; sprouting angiogenesis; cell differentiation; vascular endothelial growth factor receptor signaling pathway; transmembrane receptor protein tyrosine kinase signaling pathway; positive regulation of cell migration |
NCBI Summary: | This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia.[provided by RefSeq, May 2009] |
UniProt Code: | P17948 |
NCBI GenInfo Identifier: | 143811474 |
NCBI Gene ID: | 2321 |
NCBI Accession: | P17948.2 |
UniProt Secondary Accession: | P17948,O60722, A3E342, A3E344, A8KA71, B0LPF1, B2BF46 B2BF47, B2BF48, B3FR89, B5A923, F5H5L6, |
UniProt Related Accession: | P17948 |
Molecular Weight: | 41,175 Da |
NCBI Full Name: | Vascular endothelial growth factor receptor 1 |
NCBI Synonym Full Names: | fms-related tyrosine kinase 1 |
NCBI Official Symbol: | FLT1�� |
NCBI Official Synonym Symbols: | FLT; FLT-1; VEGFR1; VEGFR-1�� |
NCBI Protein Information: | vascular endothelial growth factor receptor 1; fms-like tyrosine kinase 1; tyrosine-protein kinase FRT; tyrosine-protein kinase receptor FLT; vascular permeability factor receptor; fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) |
UniProt Protein Name: | Vascular endothelial growth factor receptor 1 |
UniProt Synonym Protein Names: | Fms-like tyrosine kinase 1; FLT-1; Tyrosine-protein kinase FRT; Tyrosine-protein kinase receptor FLT; FLT; Vascular permeability factor receptor |
Protein Family: | Vascular endothelial growth factor receptor |
UniProt Gene Name: | FLT1�� |
UniProt Entry Name: | VGFR1_HUMAN |