Growth Factors & Cytokines Recombinant Proteins

Human FGF 23 Recombinant Protein (RPPB0250)

(No reviews yet) Write a Review
SKU:
RPPB0250
Product Type:
Recombinant Protein
Species:
Human
Uniprot:
Q9GZV9
Research Area:
Growth Factors & Cytokines

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:Human FGF 23 Recombinant Protein
Product Code:RPPB0250
Size:10µg
Species:Human
Target:FGF 23
Synonyms:Tumor-derived hypophosphatemia-inducing factor, HYPF, ADHR, HPDR2, PHPTC, FGF23, FGF-23, Fibroblast Growth Factor-23.
Source:Escherichia Coli
Physical Appearance:Sterile Filtered white lyophilized powder.
Formulation:The protein (0.5mg/ml) was lyophilized from 25mM Tris pH7.5 and 0.6M NaCl solution.
Solubility:It is recommended to reconstitute the lyophilized Fibroblast Growth Factor-23 in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions.
Stability:Lyophilized Fibroblast Growth Factor 23 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FGF-23 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Purity:Greater than 90.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Amino Acid Sequence:MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIHHHHHH
Biological Activity:Treatment with hrFGF23 has been shown to induce FGFR mediated Erk phosphorylation, reduce plasma PTH levels in rats and to reduce blood phosphate levels.

FGF-23 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-23 inhibits renal tubular phosphate transport. This gene was identified by its mutations associated with autosomal dominant hypophosphatemic rickets (ADHR), an inherited phosphate wasting disorder. Abnormally high level expression of FGF23 was found in oncogenic hypophosphatemic osteomalacia (OHO), a phenotypically similar disease caused by abnormal phosphate metabolism. Mutations FGF23 have also been shown to cause familial tumoral calcinosis with hyperphosphatemia.

Fibroblast Growth Factor-23 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain expressed with a -6xHis tag containing a total of 257 amino acids (251 a.a. FGF23+ 6 a.a. His tag) and having a molecular mass of 28629.5 Dalton. The FGF-23 is and purified by chromatographic techniques.

UniProt Protein Function:FGF23: Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL. Acts directly on the parathyroid to decrease PTH secretion. Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization. Defects in FGF23 are the cause of autosomal dominant hypophosphataemic rickets (ADHR). ADHR is characterized by low serum phosphorus concentrations, rickets, osteomalacia, leg deformities, short stature, bone pain and dental abscesses. Defects in FGF23 are a cause of hyperphosphatemic familial tumoral calcinosis (HFTC). HFTC is a severe autosomal recessive metabolic disorder that manifests with hyperphosphatemia and massive calcium deposits in the skin and subcutaneous tissues. Belongs to the heparin-binding growth factors family.
UniProt Protein Details:

Protein type:Secreted, signal peptide; Secreted; Cytokine

Chromosomal Location of Human Ortholog: 12p13.3

Cellular Component: extracellular space; extracellular region

Molecular Function:growth factor activity; type 1 fibroblast growth factor receptor binding

Biological Process: epidermal growth factor receptor signaling pathway; negative regulation of bone mineralization; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; cellular phosphate ion homeostasis; nerve growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; negative regulation of hormone secretion; insulin receptor signaling pathway; innate immune response; negative regulation of osteoblast differentiation; phosphate ion homeostasis; cell differentiation; phosphate metabolic process; vitamin D catabolic process

Disease: Hypophosphatemic Rickets, Autosomal Dominant

NCBI Summary:This gene encodes a member of the fibroblast growth factor family of proteins, which possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. The product of this gene regulates phosphate homeostasis and transport in the kidney. The full-length, functional protein may be deactivated via cleavage into N-terminal and C-terminal chains. Mutation of this cleavage site causes autosomal dominant hypophosphatemic rickets (ADHR). Mutations in this gene are also associated with hyperphosphatemic familial tumoral calcinosis (HFTC). [provided by RefSeq, Feb 2013]
UniProt Code:Q9GZV9
NCBI GenInfo Identifier:13626688
NCBI Gene ID:8074
NCBI Accession:Q9GZV9.1
UniProt Secondary Accession:Q9GZV9,Q4V758,
UniProt Related Accession:Q9GZV9
Molecular Weight:
NCBI Full Name:Fibroblast growth factor 23
NCBI Synonym Full Names:fibroblast growth factor 23
NCBI Official Symbol:FGF23��
NCBI Official Synonym Symbols:ADHR; FGFN; HYPF; HPDR2; PHPTC��
NCBI Protein Information:fibroblast growth factor 23; phosphatonin; tumor-derived hypophosphatemia inducing factor
UniProt Protein Name:Fibroblast growth factor 23
UniProt Synonym Protein Names:Phosphatonin; Tumor-derived hypophosphatemia-inducing factorCleaved into the following 2 chains:Fibroblast growth factor 23 N-terminal peptide; Fibroblast growth factor 23 C-terminal peptide
Protein Family:Fibroblast growth factor
UniProt Gene Name:FGF23��
UniProt Entry Name:FGF23_HUMAN
View AllClose

0 Reviews

View AllClose

Related Products