Human FGF-23 Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review

Description

View AllClose

View AllClose

OverviewProduct Name:Human FGF-20 Recombinant Protein (N-His) (active)Product Code:RPES6468Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-22 Recombinant Protein (N-His) (active)Product Code:RPES6469Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-12 Recombinant Protein (N-His) (active)Product Code:RPES6463Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-10 Recombinant Protein (N-His) (active)Product Code:RPES6460Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-5 Recombinant Protein (N-His) (active)Product Code:RPES6458Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-16 Recombinant Protein (N-His) (active)Product Code:RPES6466Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-6 Recombinant Protein (N-His) (active)Product Code:RPES6459Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-13 Recombinant Protein (N-His) (active)Product Code:RPES6464Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-18 Recombinant Protein (N-His) (active)Product Code:RPES6467Size:20µgSpecies:Human

Mol Mass:	28.78 kDa
Tag:	N-His
Purity:	> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:	< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:	Measure by its ability to induce proliferation in BaF3 cells transfected with human FGFRIIIc. The ED50 for this effect is < 0.3 μg/mL.

Sequence:	MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Accession:	Q9GZV9
Storage:	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:	This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:	Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:	Please refer to the printed manual for detailed information.
Background:	Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Up-regulates EGR1 expression in the presence of KL. Acts directly on the parathyroid to decrease PTH secretion. Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.

Product Name:	Human FGF-23 Recombinant Protein (N-His) (active)
Product Code:	RPES6470
Size:	20µg
Species:	Human
Expression Host:	E.coli
Synonyms:	FGFN