Name: Human FGF-16 Recombinant Protein (N-His) (active)
SKU: RPES6466
Availability: OutOfStock

Human FGF-16 Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review

SKU:

RPES6466

Product Type:

Recombinant Protein

Species:

Human

Description

View AllClose

0 Reviews

View AllClose

OverviewProduct Name:Human FGF-13 Recombinant Protein (N-His) (active)Product Code:RPES6464Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-18 Recombinant Protein (N-His) (active)Product Code:RPES6467Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-6 Recombinant Protein (N-His) (active)Product Code:RPES6459Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-14 Recombinant Protein (N-His) (active)Product Code:RPES6465Size:20µgSpecies:Human

OverviewProduct Name:Human FGF-23 Recombinant Protein (N-His) (active)Product Code:RPES6470Size:20µgSpecies:Human

Mol Mass:	24.58 kDa
Tag:	N-His
Purity:	> 95 % as determined by reducing SDS-PAGE.
Endotoxin Level:	< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:	Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 31 ng/mL. The specific activity of recombinant human FGF-16 is > 3 x 104IU/mg.

Sequence:	MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR
Accession:	O43320
Storage:	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:	This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:	Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:	Please refer to the printed manual for detailed information.
Background:	Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation, and is required for normal cardiomyocyte proliferation and heart development.