Description
| Product Name: | Human FGF-14 Recombinant Protein (N-His) (active) | 
| Product Code: | RPES6465 | 
| Size: | 20µg | 
| Species: | Human | 
| Expression Host: | E.coli | 
| Synonyms: | FHF-4, FHF4, SCA27 | 
| Mol Mass: | 28.53 kDa | 
| Tag: | N-His | 
| Purity: | > 95 % as determined by reducing SDS-PAGE. | 
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. | 
| Bio Activity: | Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 21 ng/mL. | 
| Sequence: | MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT | 
| Accession: | Q92915 | 
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. | 
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. | 
| Reconstitution: | Please refer to the printed manual for detailed information. | 
| Background: | Probably involved in nervous system development and function. |