Human FGF-12 Recombinant Protein (N-His) (active)
- SKU:
- RPES6463
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human FGF-12 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6463 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | EIEE47B, FHF1 |
| Mol Mass: | 28.23 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 2 ng/mL. |
| Sequence: | MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
| Accession: | P61328 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Fibroblast Growth Factor 12 (FGF-12) is a member of the fibroblast growth factor (FGF) family. FGF-12 is probably involved in nervous system development and function. FGF-12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfectedinto mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Related Products
Human FGF-14 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FGF-14 Recombinant Protein (N-His) (active)Product Code:RPES6465Size:20µgSpecies:Human
Human FGF-13 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FGF-13 Recombinant Protein (N-His) (active)Product Code:RPES6464Size:20µgSpecies:Human
Human FGF-18 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FGF-18 Recombinant Protein (N-His) (active)Product Code:RPES6467Size:20µgSpecies:Human
Human FGF-5 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FGF-5 Recombinant Protein (N-His) (active)Product Code:RPES6458Size:20µgSpecies:Human
Human FGF-20 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FGF-20 Recombinant Protein (N-His) (active)Product Code:RPES6468Size:20µgSpecies:Human