Human FGF-11 isoform 2 Recombinant Protein (N-His) (active)
(No reviews yet)
Write a Review
- SKU:
- RPES6462
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human FGF-11 isoform 2 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6462 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | FHF-3, FHF3 |
| Mol Mass: | 25.83 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is < 1 ng/mL. |
| Sequence: | MAALASSLIRQKREVREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP |
| Accession: | Q92914 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Probably involved in nervous system development and function. |
Related Products
Human FGF-11 isoform 1 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FGF-11 isoform 1 Recombinant Protein (N-His) (active)Product Code:RPES6461Size:20µgSpecies:Human<
Human FGF-20 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FGF-20 Recombinant Protein (N-His) (active)Product Code:RPES6468Size:20µgSpecies:Human
Human FGF-22 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FGF-22 Recombinant Protein (N-His) (active)Product Code:RPES6469Size:20µgSpecies:Human
Human FGF-12 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FGF-12 Recombinant Protein (N-His) (active)Product Code:RPES6463Size:20µgSpecies:Human
Human FGF-10 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FGF-10 Recombinant Protein (N-His) (active)Product Code:RPES6460Size:20µgSpecies:Human