Cytokines Recombinant Proteins
Human EBI3 Recombinant Protein (RPPB0157)
- SKU:
- RPPB0157
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- Q14213
- Research Area:
- Cytokines
Description
| Product Name: | Human EBI3 Recombinant Protein |
| Product Code: | RPPB0157 |
| Size: | 10µg |
| Species: | Human |
| Target: | EBI3 |
| Synonyms: | Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol. |
| Solubility: | It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. |
| Purity: | Greater than 90% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK |
| Biological Activity: | Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody. |
EBI3 has an induced expression in B lymphocytes in reaction to Epstein-Barr virus infection. EBI3 encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form iIL-27. EBI3 drives rapid clonal expansion of naive cd4(+) t-cells. EBI3 strongly synergizes with IL-12 to activate IFN-gamma production of naive cd4(+) t-cells. EBI3 mediates its biologic effects through the cytokine receptor wsx-1/tccr.
EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa. The EBI3 is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | IL27-beta: Cytokine with pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon- gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines. Belongs to the type I cytokine receptor family. Type 3 subfamily. |
| UniProt Protein Details: | Protein type:Secreted, signal peptide; Secreted Chromosomal Location of Human Ortholog: 19p13.3 Cellular Component: extracellular region; extracellular space; plasma membrane Molecular Function:cytokine activity; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; interleukin-27 receptor binding; protein binding Biological Process: cytokine and chemokine mediated signaling pathway; humoral immune response; positive regulation of alpha-beta T cell proliferation; positive regulation of interferon-gamma biosynthetic process; T cell proliferation; T-helper 1 type immune response |
| NCBI Summary: | This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq, Sep 2008] |
| UniProt Code: | Q14213 |
| NCBI GenInfo Identifier: | 47605806 |
| NCBI Gene ID: | 10148 |
| NCBI Accession: | Q14213.2 |
| UniProt Secondary Accession: | Q14213,O75269, A0N0N2, |
| UniProt Related Accession: | Q14213 |
| Molecular Weight: | 25,396 Da |
| NCBI Full Name: | Interleukin-27 subunit beta |
| NCBI Synonym Full Names: | Epstein-Barr virus induced 3 |
| NCBI Official Symbol: | EBI3�� |
| NCBI Official Synonym Symbols: | IL27B; IL-27B�� |
| NCBI Protein Information: | interleukin-27 subunit beta |
| UniProt Protein Name: | Interleukin-27 subunit beta |
| UniProt Synonym Protein Names: | Epstein-Barr virus-induced gene 3 protein; EBV-induced gene 3 protein |
| Protein Family: | Interleukin |
| UniProt Gene Name: | EBI3�� |
| UniProt Entry Name: | IL27B_HUMAN |
Related Products
Human EBI3 Recombinant Protein (RPPB0158)
Cytokines Recombinant Proteins
Mouse EBI3 Recombinant Protein (RPPB0159)
Cytokines Recombinant Proteins
Rhesus Macaque EBI3 Macaque Recombinant Protein (RPPB0160)
Mouse IL-27 EBI3 Recombinant Protein (N-His) (active)
