Cytokines Recombinant Proteins

Human EBI3 Recombinant Protein (RPPB0157)

(No reviews yet) Write a Review
SKU:
RPPB0157

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:Human EBI3 Recombinant Protein
Product Code:RPPB0157
Size:10µg
Species:Human
Target:EBI3
Synonyms:Interleukin-27 subunit beta, IL-27 subunit beta, IL-27B, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein, EBI3, IL27B.
Source:Escherichia Coli
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
Solubility:It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100�g/ml, which can then be further diluted to other aqueous solutions.
Stability:Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Purity:Greater than 90% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Amino Acid Sequence:RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Biological Activity:Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.

EBI3 has an induced expression in B lymphocytes in reaction to Epstein-Barr virus infection. EBI3 encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form iIL-27. EBI3 drives rapid clonal expansion of naive cd4(+) t-cells. EBI3 strongly synergizes with IL-12 to activate IFN-gamma production of naive cd4(+) t-cells. EBI3 mediates its biologic effects through the cytokine receptor wsx-1/tccr.

EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa. The EBI3 is purified by proprietary chromatographic techniques.

UniProt Protein Function:IL27-beta: Cytokine with pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon- gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines. Belongs to the type I cytokine receptor family. Type 3 subfamily.
UniProt Protein Details:

Protein type:Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular region; extracellular space; plasma membrane

Molecular Function:cytokine activity; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; interleukin-27 receptor binding; protein binding

Biological Process: cytokine and chemokine mediated signaling pathway; humoral immune response; positive regulation of alpha-beta T cell proliferation; positive regulation of interferon-gamma biosynthetic process; T cell proliferation; T-helper 1 type immune response

NCBI Summary:This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq, Sep 2008]
UniProt Code:Q14213
NCBI GenInfo Identifier:47605806
NCBI Gene ID:10148
NCBI Accession:Q14213.2
UniProt Secondary Accession:Q14213,O75269, A0N0N2,
UniProt Related Accession:Q14213
Molecular Weight:25,396 Da
NCBI Full Name:Interleukin-27 subunit beta
NCBI Synonym Full Names:Epstein-Barr virus induced 3
NCBI Official Symbol:EBI3��
NCBI Official Synonym Symbols:IL27B; IL-27B��
NCBI Protein Information:interleukin-27 subunit beta
UniProt Protein Name:Interleukin-27 subunit beta
UniProt Synonym Protein Names:Epstein-Barr virus-induced gene 3 protein; EBV-induced gene 3 protein
Protein Family:Interleukin
UniProt Gene Name:EBI3��
UniProt Entry Name:IL27B_HUMAN
View AllClose

Additional Information

Product Type:
Recombinant Protein
Species:
Human
Uniprot:
Q14213
Research Area:
Cytokines
View AllClose

Related Products