Human CD326 Recombinant Protein (N-His) (active)
- SKU:
- RPES6488
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human CD326 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6488 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | EPCAM, DIAR5, EGP-2, EGP314, EGP40, ESA, HNPCC8, KS1/4, KSA, M4S1, MIC18, MK-1, TACSTD1, TROP1 |
| Mol Mass: | 35.76 kDa |
| Tag: | N-His |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by the ability of the immobilized protein to support the adhesion of the 3T3. The ED50 for this effect is 0.2-1.7 ng/mL. |
| Sequence: | MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA |
| Accession: | P16422 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E. |
Related Products
Human CD27L Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD27L Recombinant Protein (N-His) (active)Product Code:RPES6430Size:20µgSpecies:Human
Human TWEAK Recombinant Protein (N-His) (active)
OverviewProduct Name:Human TWEAK Recombinant Protein (N-His) (active)Product Code:RPES6436Size:20µgSpecies:Human
Human LIGHT, Human Recombinant Protein (N-His) (active)
OverviewProduct Name:Human LIGHT, Human Recombinant Protein (N-His) (active)Product Code:RPES6433Size:20µgSpecies:Human
Human FasL Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FasL Recombinant Protein (N-His) (active)Product Code:RPES6432Size:20µgSpecies:Human
Human CXCL11 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL11 Recombinant Protein (N-His) (active)Product Code:RPES6504Size:20µgSpecies:Human
Human CXCL9 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL9 Recombinant Protein (N-His) (active)Product Code:RPES6503Size:20µgSpecies:Human
Human CXCL4 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL4 Recombinant Protein (N-His) (active)Product Code:RPES6501Size:20µgSpecies:Human
Human VEGF165 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human VEGF165 Recombinant Protein (N-His) (active)Product Code:RPES6434Size:20µgSpecies:Human<
Human CXCL6 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL6 Recombinant Protein (N-His) (active)Product Code:RPES6502Size:20µgSpecies:Human