Cytokines Recombinant Proteins
Human BMP 7 Recombinant Protein (RPPB0105)
- SKU:
- RPPB0105
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- P18075
- Research Area:
- Cytokines
Description
| Product Name: | Human BMP 7 Recombinant Protein |
| Product Code: | RPPB0105 |
| Size: | 5µg |
| Species: | Human |
| Target: | BMP 7 |
| Synonyms: | Osteogenic Protein 1, BMP-7. |
| Source: | HEK293 Cells |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The BMP7 was lyophilized from 1mg/ml in 1xPBS. |
| Solubility: | It is recommended to reconstitute the lyophilized BMP-7 in sterile water not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized BMP7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP-7 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95% as obsereved by SDS-PAGE. |
| Amino Acid Sequence: | DFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAM AVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPR YHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLDSRTLWASE EGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKAT |
| Biological Activity: | The specific activity was determined by the dose dependent induction of alkaline phosphatase production in the ATDC-5 cell line (Mouse chondrogenic cell line) and is typically 50-250ng/ml. |
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
BMP-7 Human Recombinant produced in HEK cells is a glycosylated disulfide-linked homodimer, having a molecular weight range of 30-38kDa due to glycosylation.The BMP7 corresponds to amino acid residues 315 to 431 of the full-length BMP-7 precursor and is purified by proprietary chromatographic techniques.
| UniProt Code: | P18075 |
| NCBI GenInfo Identifier: | 115078 |
| NCBI Gene ID: | 655 |
| NCBI Accession: | P18075.1 |
| UniProt Secondary Accession: | P18075,Q9H512, Q9NTQ7, |
| UniProt Related Accession: | P18075 |
| Molecular Weight: | 431 |
| NCBI Full Name: | Bone morphogenetic protein 7 |
| NCBI Synonym Full Names: | bone morphogenetic protein 7 |
| NCBI Official Symbol: | BMP7�� |
| NCBI Official Synonym Symbols: | OP-1�� |
| NCBI Protein Information: | bone morphogenetic protein 7; osteogenic protein 1 |
| UniProt Protein Name: | Bone morphogenetic protein 7 |
| UniProt Synonym Protein Names: | Osteogenic protein 1; OP-1; INN: Eptotermin alfa |
| Protein Family: | Bone morphogenetic protein |
| UniProt Gene Name: | BMP7�� |
| UniProt Entry Name: | BMP7_HUMAN |
Related Products
Human BMP 7 Recombinant Protein (RPPB0104)
Cytokines Recombinant Proteins
Human BMP 7 Recombinant Protein (RPPB0102)
Cytokines Recombinant Proteins
Human BMP 7 Recombinant Protein (RPPB0101)
Cytokines Recombinant Proteins
Human BMP-7 Recombinant Protein (His tag)
Human BMP 2 Protein Recombinant Protein (RPPB0092)
Cytokines Recombinant Proteins