Description
| Product Name: | Human BMP 7 Recombinant Protein |
| Product Code: | RPPB0104 |
| Size: | 10µg |
| Species: | Human |
| Target: | BMP 7 |
| Synonyms: | Osteogenic Protein 1, BMP-7. |
| Source: | Nicotiana benthamiana |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4. |
| Solubility: | Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/�l. |
| Stability: | Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 97.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH |
| Biological Activity: | The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50�is less than�40ng/ml, corresponding to a specific activity of 25,000 units/mg. |
The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques.
| UniProt Code: | P18075 |
| NCBI GenInfo Identifier: | 115078 |
| NCBI Gene ID: | 655 |
| NCBI Accession: | P18075.1 |
| UniProt Secondary Accession: | P18075,Q9H512, Q9NTQ7, |
| UniProt Related Accession: | P18075 |
| Molecular Weight: | 431 |
| NCBI Full Name: | Bone morphogenetic protein 7 |
| NCBI Synonym Full Names: | bone morphogenetic protein 7 |
| NCBI Official Symbol: | BMP7�� |
| NCBI Official Synonym Symbols: | OP-1�� |
| NCBI Protein Information: | bone morphogenetic protein 7; osteogenic protein 1 |
| UniProt Protein Name: | Bone morphogenetic protein 7 |
| UniProt Synonym Protein Names: | Osteogenic protein 1; OP-1; INN: Eptotermin alfa |
| Protein Family: | Bone morphogenetic protein |
| UniProt Gene Name: | BMP7�� |
| UniProt Entry Name: | BMP7_HUMAN |
Additional Information
Product Type: |
Recombinant Protein |
Species: |
Human |
Uniprot: |
P18075 |
Research Area: |
Cytokines |