Human BMP-5 Recombinant Protein (N-His) (active)
- SKU:
- RPES6439
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human BMP-5 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6439 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Mol Mass: | 52.57 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 0.17 μg/mL. |
| Sequence: | MHLTVFLLKGIVGFLWSCWVLVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILGLPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASPNGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKAQALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH |
| Accession: | P22003 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printe |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including cartilage and bone formation or neurogenesis. Initiates the canonical BMP signaling cascade by associating with type I receptor BMPR1A and type II receptor BMPR. In turn, BMPR1A propagates signal by phosphorylating SMAD1/5/8 that travel to the nucleus and act as activators and repressors of transcription of target genes. Can also signal through non-canonical pathway such as MAPK p38 signaling cascade to promote chondrogenic differentiation. |
Related Products
Human BMP-11 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human BMP-11 Recombinant Protein (N-His) (active)Product Code:RPES6446Size:20µgSpecies:Human
Human BMP-10 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human BMP-10 Recombinant Protein (N-His) (active)Product Code:RPES6445Size:20µgSpecies:Human
Human BMP-8a Recombinant Protein (N-His) (active)
OverviewProduct Name:Human BMP-8a Recombinant Protein (N-His) (active)Product Code:RPES6442Size:20µgSpecies:Human
Human BMP-13 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human BMP-13 Recombinant Protein (N-His) (active)Product Code:RPES6448Size:20µgSpecies:Human
Human BMP-3 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human BMP-3 Recombinant Protein (N-His) (active)Product Code:RPES6437Size:20µgSpecies:Human