Human BMP-12 Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review

Description

View AllClose

View AllClose

OverviewProduct Name:Human BMP-8a Recombinant Protein (N-His) (active)Product Code:RPES6442Size:20µgSpecies:Human

OverviewProduct Name:Human BMP-13 Recombinant Protein (N-His) (active)Product Code:RPES6448Size:20µgSpecies:Human

OverviewProduct Name:Human BMP-3 Recombinant Protein (N-His) (active)Product Code:RPES6437Size:20µgSpecies:Human

OverviewProduct Name:Human BMP-11 Recombinant Protein (N-His) (active)Product Code:RPES6446Size:20µgSpecies:Human

OverviewProduct Name:Human BMP-10 Recombinant Protein (N-His) (active)Product Code:RPES6445Size:20µgSpecies:Human

OverviewProduct Name:Human BMP-5 Recombinant Protein (N-His) (active)Product Code:RPES6439Size:20µgSpecies:Human

OverviewProduct Name:Human BMP-6 Recombinant Protein (N-His) (active)Product Code:RPES6440Size:20µgSpecies:Human

OverviewProduct Name:Human BMP-7 Recombinant Protein (N-His) (active)Product Code:RPES6441Size:20µgSpecies:Human

OverviewProduct Name:Human BMP-4 Recombinant Protein (N-His) (active)Product Code:RPES6438Size:20µgSpecies:Human

Mol Mass:	47.78 kDa
Tag:	N-His
Purity:	> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:	< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:	Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 112 ng/mL.

Sequence:	MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPVRSPGGGGGGGGGGRTLAQAAGAAAVPAAAVPRARAARRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAGAAAVSASGHGRADTITGFTDQATQDESAAETGQSFLFDVSSLNDADEVVGAELRVLRRGSPESGPGSWTSPPLLLLSTCPGAARAPRLLYSRAAEPLVGQRWEAFDVADAMRRHRREPRPPRAFCLLLRAVAGPVPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESLFREIRAQARALGAALASEPLPDPGTGTASPRAVIGGRRRRRTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Accession:	Q7Z4P5
Storage:	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:	This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:	Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printe
Reconstitution:	Please refer to the printed manual for detailed information.
Background:	May play an active role in the motor area of the primate neocortex.

Product Name:	Human BMP-12 Recombinant Protein (N-His) (active)
Product Code:	RPES6447
Size:	20µg
Species:	Human
Expression Host:	E.coli
Synonyms:	Growth/Differentiation Factor-7,GDF-7