Cytokines Recombinant Proteins
Human ANGPT2 Recombinant Protein (RPPB0034)
- SKU:
- RPPB0034
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- O15123
- Research Area:
- Cytokines
Description
| Product Name: | Human ANGPT2 Recombinant Protein |
| Product Code: | RPPB0034 |
| Size: | 10µg |
| Species: | Human |
| Target: | ANGPT2 |
| Synonyms: | Angiopoietin-2, Angiopoietin2, ANGPT2, ANG2,�ANG-2, ANGPT-2. |
| Source: | Chinese Hamster Ovary Cells (CHO) |
| Physical Appearance: | Sterile filtered colorless solution. |
| Formulation: | ANGPT2 protein solution (0.25mg/ml) contains Phosphate buffered saline (pH7.4) and 10% glycerol. |
| Stability: | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Purity: | Greater than 90.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | YNNFRKSMDS IGKKQYQVQH GSCSYTFLLP EMDNCRSSSS PYVSNAVQRD APLEYDDSVQRLQVLENIME NNTQWLMKLE NYIQDNMKKEMVEIQQNAVQ NQTAVMIEIG TNLLNQTAEQTRKLTDVEAQ VLNQTTRLEL QLLEHSLSTN KLEKQILDQT SEINKLQDKNSFLEKKVLAMEDKHIIQLQS IKEEKDQLQV LVSKQNSIIE ELEKKIVTAT VNNSVLQKQQHDLMETVNNL LTMMSTSNSA KDPTVAKEEQ ISFRDCAEVFKSGHTTNGIY TLTFPNSTEEIKAYCDMEAG GGGWTIIQRR EDGSVDFQRT WKEYKVGFGN PSGEYWLGNE FVSQLTNQQRYVLKIHLKDWEGNEAYSLYE HFYLSSEELN YRIHLKGLTG TAGKISSISQ PGNDFSTKDGDNDKCICKCS QMLTGGWWFD ACGPSNLNGM YYPQRQNTNKFNGIKWYYWK GSGYSLKATT MMIRPADFHH HHHH |
ANGPT2 aka Angiopoietin-2 competes for binding to the TIE2 receptor and blocks angiopoietin-1 aka ANGPT1 induced TIE2 autophosphorylation during vasculogenesis. ANGPT-2 is a naturally occurring antagonist of ANGPT-1. ANGPT2 induces tyrosine phosphorylation of TEK/TIE2 in the lack of Angiopoietin-2. In the deficiency of VEGF an angiogenic inducer, ANGPT-2 induces endothelial cell apoptosis resulting in vascular regression. ANGPT2 along with VEGF enable endothelial cell migration and proliferation, resulting in permissive angiogenic signal.
ANGPT2 produced in Chinese hamster ovary (CHO) cells by recombinant DNA technology is a single, polypeptide chain (19-496 a.a.) and fused to a 6 aa His Tag at C-terminus containing a total of 484 amino acids and having a molecular mass of 55.7kDa.ANGPT2 shows multiple bands between 50-100kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.
| UniProt Protein Function: | ANGPT2: Binds to TEK/TIE2, competing for the ANGPT1 binding site, and modulating ANGPT1 signaling. Can induce tyrosine phosphorylation of TEK/TIE2 in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal. Interacts with TEK/TIE2, competing for the same binding site as ANGPT1. 3 isoforms of the human protein are produced by alternative splicing. |
| UniProt Protein Details: | Protein type:Secreted, signal peptide; Secreted Chromosomal Location of Human Ortholog: 8p23.1 Cellular Component: extracellular space; cell projection; extracellular region; plasma membrane; nucleus Molecular Function:protein binding; metal ion binding; receptor tyrosine kinase binding; receptor binding Biological Process: Tie receptor signaling pathway; organ regeneration; maternal process involved in pregnancy; signal transduction; negative regulation of blood vessel endothelial cell migration; response to organic cyclic substance; germ cell development; negative regulation of positive chemotaxis; response to radiation; negative regulation of angiogenesis; positive regulation of angiogenesis; response to mechanical stimulus; response to hypoxia; response to glucose stimulus; angiogenesis; response to activity; blood coagulation; leukocyte migration |
| NCBI Summary: | The protein encoded by this gene is an antagonist of angiopoietin 1 (ANGPT1) and endothelial TEK tyrosine kinase (TIE-2, TEK). The encoded protein disrupts the vascular remodeling ability of ANGPT1 and may induce endothelial cell apoptosis. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| UniProt Code: | O15123 |
| NCBI GenInfo Identifier: | 12229555 |
| NCBI Gene ID: | 285 |
| NCBI Accession: | O15123.1 |
| UniProt Secondary Accession: | O15123,Q9NRR7, Q9P2Y7, A0AV38, A8K205, B7ZLM7, |
| UniProt Related Accession: | O15123 |
| Molecular Weight: | 56,848 Da |
| NCBI Full Name: | Angiopoietin-2 |
| NCBI Synonym Full Names: | angiopoietin 2 |
| NCBI Official Symbol: | ANGPT2�� |
| NCBI Official Synonym Symbols: | ANG2; AGPT2�� |
| NCBI Protein Information: | angiopoietin-2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a |
| UniProt Protein Name: | Angiopoietin-2 |
| UniProt Gene Name: | ANGPT2�� |
| UniProt Entry Name: | ANGP2_HUMAN |