Human AITRL Recombinant Protein (N-His) (active)
- SKU:
- RPES6429
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human AITRL Recombinant Protein (N-His) (active) |
| Product Code: | RPES6429 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | TL6, GITRL, TNLG2A, hGITRL, TNFSF18 |
| Mol Mass: | 21.13 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is < 2. 5 ng/mL. |
| Sequence: | MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS |
| Accession: | Q9UNG2 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells. |
Related Products
Human TPO Recombinant Protein (N-His) (active)
OverviewProduct Name:Human TPO Recombinant Protein (N-His) (active)Product Code:RPES6476Size:20µgSpecies:HumanE
Human CD326 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD326 Recombinant Protein (N-His) (active)Product Code:RPES6488Size:20µgSpecies:Human
Human TWEAK Recombinant Protein (N-His) (active)
OverviewProduct Name:Human TWEAK Recombinant Protein (N-His) (active)Product Code:RPES6436Size:20µgSpecies:Human
Human CXCL11 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL11 Recombinant Protein (N-His) (active)Product Code:RPES6504Size:20µgSpecies:Human
Human APRIL Recombinant Protein (N-His) (active)
OverviewProduct Name:Human APRIL Recombinant Protein (N-His) (active)Product Code:RPES6428Size:20µgSpecies:Human