Viral Recombinant Proteins
HPV 18 Recombinant Protein (RPPB5612)
- SKU:
 - RPPB5612
 - Product Type:
 - Recombinant Protein
 - Species:
 - Viral
 
Description
| Product Name: | HPV 18 Recombinant Protein | 
| Product Code: | RPPB5612 | 
| Size: | 0.5mg | 
| Species: | HPV | 
| Target: | 18 | 
| Synonyms: | Papillomavirus, HPV, Papilloma Virus. | 
| Source: | Escherichia Coli | 
| Physical Appearance: | Sterile filtered clear liquid formulation. | 
| Formulation: | Recombinant HPV-18 solution in PBS and 2M Urea. | 
| Purity: | Protein is >90% pure as determined by 10% PAGE (Coomassie staining). | 
| Amino Acid Sequence: | VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA | 
Human papillomavirus family consist of over 200 types. Over than 30 to 40 types of HPV are transferred via sexual contact and infect the anogenital region initiating genital warts. Persistent infection with "high-risk" HPV types results in skin warts and leads to precancerous lesions and invasive cancer. HPV infection is considered as a source for all incidents of cervical cancer. E2, E6, and E7 proteins of HPV-16 and 18 are considered the main viral oncoproteins that take part in cervical cancer. The type-specific antigen epitopes of E2, E6, and E7 proteins of HPV-16 are fused together and expressed in E. coli for diagnostic purpose.
The Recombinant HPV-18 is a full length large capsid protein having an Mw of 55kDa expressed in E. coli and fused to a GST-Tag at n-terminal, having a total Mw of 78kDa, purified by standard chromatography.