Viral Recombinant Proteins
HCV NS4 a+b Recombinant Protein (RPPB5461)
- SKU:
- RPPB5461
- Product Type:
- Recombinant Protein
- Species:
- Viral
Description
Product Name: | HCV NS4 a+b Recombinant Protein |
Product Code: | RPPB5461 |
Size: | 0.5mg |
Species: | HCV |
Target: | NS4 a+b |
Source: | Escherichia Coli |
Formulation: | 20mM Tris-HCl pH 8, 8M urea. |
Stability: | HCV NS4 a+b although stable at 4°C for 1 week, should be stored below -18°C.�Please prevent freeze thaw cycles. |
Purity: | HCV NS4 a+b protein is >95% pure as determined by 10% PAGE (coomassie staining). |
Amino Acid Sequence: | 1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863 |
HCV is a small 50nm, enveloped, single-stranded, positive sense RNAvirus in the family Flaviviridae. HCV has a high rate of replication with approximately one trillion particles produced each day in an infected individual. Due to lack of proofreading by the HCV RNA polymerase, the HCV has an exceptionally high mutation rate, a factor that may help it elude the host's immune response. Hepatitis C virus is classified into six genotypes(1-6) with several subtypes within each genotype. The preponderance and distribution of HCV genotypes varies globally. Genotype is clinically important in determining potential response to interferon-based therapy and the required duration of such therapy. Genotypes 1 and 4 are less responsive to interferon-based treatment than are the other genotypes (2, 3, 5 and 6).
The E.coli derived 19 kDa recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fused with b-galactosidase (114 kDa) at N-terminus, pI 5.45.