Viral Recombinant Proteins

HBsAg preS2 Recombinant Protein (RPPB5526)

(No reviews yet) Write a Review
SKU:
RPPB5526
Product Type:
Recombinant Protein
Species:
Viral

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:HBsAg preS2 Recombinant Protein
Product Code:RPPB5526
Size:50µg
Target:HBsAg preS2
Source:Escherichia Coli
Formulation:HBsAg protein was lyophilized from 0.2?m filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.
Solubility:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20�C. Further dilutions should be made in appropriate buffered solutions.
Stability:This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C.�Avoid repeated freeze/thaw cycles.
Purity:Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Amino Acid Sequence:MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN

Hepatitis B virus (HBV) is a human pathogen, causing serious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanning S domain. In addition, MHBs has a 55 amino acid region called preS2.

The Recombinant Hepatitis B Surface Antigen preS2 is approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique.

View AllClose

0 Reviews

View AllClose

Related Products